Medicine Grade Injectable Peptide CAS 38916-34-6 Somatostatin Acetate Somatostatin Peptide Raw Powder

• Certification: QS, CCC, ISO
• Shape: Powder
• Type: Coloring Adsorption
• Advantage 1: Pharmaceutical Grade, Factory Price
• Advantage 2: USA Australia UK Germany Warehouse Supply
• Advantage 3: Cash, Bank Transfer, Cryptocurrency
• Model NO.: 38916-34-6
• Product Nume: Somatostatin Acetate
• Synonyms: Somatostatin
• Function: Vitamin Additives
• Transport Package: 1kg 25kg
• Specification: 99.8% purity
• Trademark: SIgma audley
• Origin: China
• HS Code: 2923900091
• Production Capacity: 100000PC/Year

Product Description

Our core Advantage

 

   

Product Description

 

Product Name	Somatostatin
CAS NO.	910463-68-2
Appearance	powder
Purity	99% or customized
Application	api
Usage	PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Specification	1kg 5kg 25kg
Delivery time	5-6 days fast delivery free customs clear DDP

 

 

Description
  Somatostatin is a cyclic 14-peptide that was first isolated by Guillemin in 1973 and is probably the most thoroughly investigated and most important of the inhibitory factors produced by the hypothalamus. The principal activity of somatostatin, which is of hypothalamic origin, is inhibition of the release of growth hormone (GH) from the anterior pituitary. Too much GH, as in pituitary tumors, causes acromegaly, a form of giantism. On the other hand, too little GH leads to dwarfism. Somatostatin also has been found in the pancreas and the GI tract, where it inhibits the secretion of both insulin and glucagon from the pancreas as well as the secretion of a variety of intestinal peptides (e.g., gastrin, secretin, pepsin, and renin). The short half-life of somatostatin, which is less than 3 minutes, has precluded its use as a therapeutic agent. Many derivatives of somatostatin have been prepared to increase its duration of action and/or to enhance its selectivity of action. The culmination of these structure-activity studies was the development of octreotide acetate
Uses
 Somatostatin regulates the secretion of hormones and bioactive peptides. It acts as an inhibitor in the digestive tract by inhibiting gastrin release. In the pancreatic islets, it inhibits glucagon and insulin release. Somatostatin and its synthetic analogs have been used in the treatment of neuroendocrine tumors
Definition
Parathyroid hormone (PTH) is a parathyroid-secreted polypeptide hormone that increases the level of calcium in blood by enhancing calcium mobilization from bone, increasing the calcium:phosphate ratio in the kidney and promoting the absorption of calcium by the intestines. PTH is an anabolic agent that improves osteoblastic bone development. PTH 1-34 induces bone morphogenetic protein (BMP) gene transcription. Active N-terminal fragment of PTH (residues 1-34), has been used as a therapeutic for postmenopausal women with osteoporosis who are at high risk for fracture

Overseas warehouse support

     Overseas warehouses in Canada, the United States, Mexico, Australia, Germany, the Netherlands, and Belgium support cash transactions, warehouse pick-up of packages, or private truck delivery. The world's fastest and professional warehousing and transportation team!

   Currently we have 6 different warehouses in Germany throughout Europe and three warehouses in the Netherlands. Poland, Spain, Belgium, Hungary. We have a complete warehouse service system. We can ship your package quickly and only takes 1-2 days for delivery. If you have a large package you can pick it up at our warehouse or we can ship it to you quickly with a private truck and deliver it the same day. This is currently the most popular service model for all our clients. We can provide you with exclusive overseas warehouses and customized transportation routes. Looking forward to your consultation and cooperation.

 

  Providing warehousing services at warehouses in Sydney and Melbourne, Australia. We stock a large number of local hot-selling products in our local warehouse. You can collect it from the warehouse or use Australia Post to have it delivered to your parcel locker address. We offer the fastest shipping mode, overnight delivery. Of course we can also deliver large quantities of parcels using private trucking. We have a mature business model in Australia. And gained the trust of a large number of Australian customers. You can buy almost all the best-selling products in the Australian warehouse. All products are privately packaged, safer and faster.

   We have established complete warehouses in Vancouver and Toronto, Canada. We stock a large selection of local hot selling products in our local warehouse. You can pick up your package at the warehouse, or have your package delivered using Canada Post, UPS, private truck, etc. We have a mature business model in Canada. And gained the trust of a large number of Canadian customers. If you have a larger market for new products we can pay you after a large quantity of stock arrives at the warehouse.

 

Packaging & Shipping

Product packaging: We provide packaging of different specifications according to customer needs. Meet all customer needs. Different packaging is used for different chemical powders and liquids. We can also do privacy packaging customized according to your requirements. For the most basic packaging, we use aluminum foil bags sealed with double-layer vacuum packaging. We can provide packaging of different specifications: 1Kg 2kg 5Kg 10kg 20kg 25kg 200kg. Use high-hardness cartons and filling materials to avoid product damage during transportation. The customer receives a satisfied product.
 

 

Product transportation: We have warehouses in the United States, Canada, Mexico, and Australia and can ship from overseas warehouses. Improve our shipping efficiency. Let customers receive packages quickly. In addition, we have cooperation with international express delivery companies such as FEDEX, UPS, TNT EMS, etc. In addition, we are better at using dedicated air freight lines for transportation. Specializing in the transportation of chemical products and other international logistics. You can receive your package safely. Customers are not required to provide customs clearance information. We provide DDP services. Door to door service. There is no need to sign for the package in person. We have more than ten years of chemical trading experience.

 

Company Profile

      Henan Sigma Audley New Material Technology Co., Ltd. is headquartered in the international metropolis Henan. It is a company dedicated to the research, development, production and sales of organic compounds, pharmaceutical intermediates and chemical raw materials. The company has a long-term partnership with Shanghai Research Institute of Chemical Industry and its affiliated universities. It is a research and development enterprise of new pharmaceutical and chemical materials that adapts to the needs of the global pharmaceutical market. Continuously innovate world-leading new chemical and pharmaceutical products. Integrating innovative drug research and development, industrialization and market operations. The company has strong technical force, advanced equipment, strict quality management system and excellent after-sales service. Over the years, our products have been widely sold to many countries and regions, and we have established stable cooperative relationships with traders and end-users around the world. And relying on a strong logistics system, it has established its own overseas warehouses in the United States, Mexico, Canada, the Netherlands and other places. Local hot-selling products can be shipped from overseas warehouses. Well received by local customers. And has become a solid bridge between suppliers, traders and end users. We look forward to more cooperation with you.

FAQ

High quality with competitive price
 1)standard: enterprise standard
 2)all purity≥99%
 3)we are manufacturer and can provide high quality products with factory price. 
Fast and safe delivery
 1)parcel can be sent out in 24 hours after payment. tracking number available
 2)secure and discreet shipment. various transportation methods for your choice.
 3)customs pass rate ≥99%
 4) we have our own agent/re-mailer/distributor who can help us ship our products very fast and safe, and we have stock in there
for transferring. 
We have clients throughout the world
 1)professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their desire.
 2)market feedback and goods feedback will be appreciated, meeting customers's requirement is our responsibility.
 3)high quality,competitive price,fast delivery ,first-class service gain the trust and praise from the customers.