Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization

• Product Name: Thymosin Alpha-1
• CAS No.: Teriparatide Acetate
• Form: Powder
• Delivery Time: 8-12days
• Payment Method: Btc, Usdt, Wu, Bank Transfer, Paypal
• Transport Package: Box
• Model NO.: 52232-67-4
• Trademark: Henan Sigma Audley
• Origin: China
• HS Code: 9001100001
• Production Capacity: 10tons/Month

Product Description

 Henan Sigma Audley New Material Technology Co., Ltd.

 

Product Description

English name	Teriparatide Acetate
Cas number	52232-67-4
Synonyms	PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Purity	99%
delivery	8-12days
Delivery time	Next day of payment
Mode of transport	Sea, air and truck transport
Express delivery	EMS,UPS,FedEx,DHL,TNT

USES:A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

Hot Product

Our Advantages

         We have our own warehouses in Australia, USA, Germany, Canada and many other countries, which greatly saves the transportation time, and customers can get the package faster. In addition, customers can also choose to pick up services.




We have customers from all over the world who are satisfied with the quality of our products
 

We have fast logistics that allows you to get your package earlier!

Packaging & Shipping

 

Company Profile

Henan Sigma Audley New Material Technology Co., Ltd. -After more than ten years of development since its establishment, the company has established a good reputation in the fields of analysis, chemistry, and medicine. Its products and services involve scientific research, culture and education, agriculture, forestry and environmental protection, inspection and quarantine, petrochemical industry, and bioengineering., medical pharmaceuticals, and food and beverage industries, the production varieties include general and special categories. The company pays attention to consolidating its internal strength, attracts a group of professional management, marketing and scientific and technological talents, and establishes a modern enterprise management system. 

 

laboratory


Our factory

 

FAQ

1. Are you a manufacturer or trading company?
A: We are a manufacturer and welcome to visit our factory.
 
2. How to confirm the product quality before placing an order?
A: We can provide you with the sample. Also, we have the inspection report issued by the authoritative third-party testing agency.
 
3: What's your MOQ?
A:  It depends on different products. We accept sample orders. Also for some products, we can provide you with a free sample.
 
4:Do you provide after-sales service?
A: We provide 24-hour customer service. If you encounter any product quality problems or transportation problems, please feel free to contact us.
 
5:How about delivery time and method?
A: We usually ship within 3-5 working days after payments. 
We can make ships by sea, air, and express. Also can make door-to-door shipping. 
 
6:How to solve the after-sale disputes?
A: We accept changing or refunding services if there is any quality problem.